PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.18351s0323.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 219aa    MW: 25285.3 Da    PI: 4.9553
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.18351s0323.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.82.2e-1961114457
                           -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
              Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                           ++++++eq++ Le  Fe ++++  e++ +LA +lgL+ rqV vWFqNrRa++k+
  Bostr.18351s0323.2.p  61 KRKLSDEQVRMLEISFEDDHKLESERKDRLALELGLDPRQVAVWFQNRRARWKN 114
                           45899***********************************************95 PP

2HD-ZIP_I/II123.59.7e-4060151293
           HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                           +kr+ls+eqv++LE sFe ++kLe+erK +la eLgl+prqvavWFqnrRAR+k+kq+E +y++Lk+ay++++ e++rL++ev +L+e+
  Bostr.18351s0323.2.p  60 RKRKLSDEQVRMLEISFEDDHKLESERKDRLALELGLDPRQVAVWFQNRRARWKNKQVEDEYSKLKNAYENVVVEKCRLDSEVLHLKEQ 148
                           8***************************************************************************************9 PP

           HD-ZIP_I/II  91 lke 93 
                           l e
  Bostr.18351s0323.2.p 149 LYE 151
                           976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.76355115IPR001356Homeobox domain
SuperFamilySSF466891.58E-1855116IPR009057Homeodomain-like
SMARTSM003895.3E-2058119IPR001356Homeobox domain
CDDcd000861.69E-1760116No hitNo description
PfamPF000461.3E-1661114IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-2062122IPR009057Homeodomain-like
PRINTSPR000313.6E-58695IPR000047Helix-turn-helix motif
PROSITE patternPS00027090113IPR017970Homeobox, conserved site
PRINTSPR000313.6E-595111IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MNNQNVDDHN LLLISQLYPD VYTPLVPQQG EAKPARRRKR KTKSVAVAEE GGDGGNGWFR  60
KRKLSDEQVR MLEISFEDDH KLESERKDRL ALELGLDPRQ VAVWFQNRRA RWKNKQVEDE  120
YSKLKNAYEN VVVEKCRLDS EVLHLKEQLY EAEREIQRLA QRVEGTLSNS PISSSVTVEA  180
NHATPFFGDY DISVDVDGEN LLYSPDYIDG LEWMSQFI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1107115RRARWKNKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935530.0AB493553.1 Arabidopsis thaliana At2g18550 mRNA for hypothetical protein, partial cds, clone: RAAt2g18550.
GenBankBT0313620.0BT031362.1 Arabidopsis thaliana unknown protein (At2g18550) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298525.11e-146hypothetical protein CARUB_v10014603mg
SwissprotQ9ZU701e-144ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLR0I4Z61e-146R0I4Z6_9BRAS; Uncharacterized protein
STRINGAT2G18550.11e-141(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18550.11e-135homeobox protein 21